PDB entry 2lnt

View 2lnt on RCSB PDB site
Description: Solution structure of E60A mutant AGR2
Class: cell adhesion
Keywords: Thioredoxin-fold, cancer, adhesion, metastasis, CELL ADHESION
Deposited on 2012-01-04, released 2013-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anterior gradient protein 2 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: AGR2, AG2, UNQ515/PRO1030
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95994 (5-139)
      • expression tag (0-4)
      • engineered mutation (24)
    Domains in SCOPe 2.07: d2lnta1, d2lnta2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lntA (A:)
idpftpqtlsrgwgdqliwtqtyeaalyksktsnkplmiihhldecphsqalkkvfaenk
eiqklaeqfvllnlvyettdkhlspdgqyvprimfvdpsltvraditgrysnrlyayepa
dtallldnmkkalkllktel