PDB entry 2lni

View 2lni on RCSB PDB site
Description: Solution NMR Structure of Stress-induced-phosphoprotein 1 STI1 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4403E
Class: chaperone
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-BIOLOGY, Protein Structure Initiative, CHAPERONE
Deposited on 2011-12-28, released 2012-03-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stress-induced-phosphoprotein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: STIP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31948 (11-132)
      • expression tag (0-10)
      • conflict (17-18)
    Domains in SCOPe 2.06: d2lnia1, d2lnia2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lniA (A:)
    mghhhhhhshmnpdlalmvknkgnecfqkgdypqamkhyteaikrnpkdaklysnraacy
    tkllefqlalkdceeciqleptfikgytrkaaaleamkdytkamdvyqkaldldssckea
    adgyqrcmmaqyn