PDB entry 2lms

View 2lms on RCSB PDB site
Description: A single GalNAc residue on Threonine-106 modifies the dynamics and the structure of Interferon alpha-2a around the glycosylation site
Class: immune system
Keywords: cytokine, glycoprotein, o-glycosylation, signaling protein, type I interferons, immune system
Deposited on 2011-12-12, released 2012-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lmsa_
  • Heterogens: A2G

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2lmsA (A:)
mcdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhem
iqqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilav
rkyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske

    Sequence, based on observed residues (ATOM records): (download) 
    >2lmsA (A:)
cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske