PDB entry 2lmj

View 2lmj on RCSB PDB site
Description: Itk-sh3
Class: transferase
Keywords: transferase
Deposited on 2011-12-05, released 2012-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ITK/TSK
    Species: Homo sapiens [TaxId:9606]
    Gene: ITK, EMT, LYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08881 (5-65)
      • expression tag (0-4)
    Domains in SCOPe 2.06: d2lmja1, d2lmja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lmjA (A:)
    gplgspeetvvialydyqtndpqelalrrneeyclldsseihwwrvqdrnghegyvpssy
    lveksp