PDB entry 2lm3

View 2lm3 on RCSB PDB site
Description: Structure of the rhesus monkey TRIM5alpha PRYSPRY domain
Class: ligase
Keywords: ligase
Deposited on 2011-11-21, released 2012-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tripartite motif-containing protein 5
    Species: Macaca mulatta [TaxId:9544]
    Gene: TRIM5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PF16 (2-End)
      • expression tag (1)
      • variant (17)
    Domains in SCOPe 2.07: d2lm3a1, d2lm3a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lm3A (A:)
    gteltdarrywvdvtlatnnishaviaedkrqvssrnpqimyqapgtlftfpsltnfnyc
    tgvlgsqsitsgkhywevdvskksawilgvcagfqsdamynieqnenyqpkygywviglq
    egvkysvfqdgsshtpfapfivplsviicpdrvgvfvdyeactvsffnitnhgfliykfs
    qcsfskpvfpylnprkctvpmtlcspss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lm3A (A:)
    teltdarrywvdvtlatnnishaviaedkrqvssrnpqimyqapgtlftfpsltnfnyct
    gvlgsqsitsgkhywevdvskksawilgvcagfqsdamynieqnenyqpkygywviglqe
    gvkysvfqdgsshtpfapfivplsviicpdrvgvfvdyeactvsffnitnhgfliykfsq
    csfskpvfpylnprkctvpmtlcsp