PDB entry 2lm1

View 2lm1 on RCSB PDB site
Description: Solution NMR Structure of Lysine-specific demethylase lid from Drosophila melanogaster, Northeast Structural Genomics Consortium Target FR824D
Class: DNA binding protein
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, Chaperone-Enabled Studies of Epigenetic Regulation Enzymes, CEBS, DNA BINDING PROTEIN
Deposited on 2011-11-18, released 2011-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase lid
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG9088, lid
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lm1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lm1A (A:)
    prvqrlneleaktrvklnfldqiakfwelqgsslkipmverkaldlytlhrivqeeggme
    qttkdrkwakvanrmqypssksvgatlkahyerilhpfevytsgkvl