PDB entry 2llt

View 2llt on RCSB PDB site
Description: Post-translational S-nitrosylation is an endogenous factor fine-tuning human S100A1 protein properties
Class: metal binding protein
Keywords: Ca-binding proteins, S-nitrosylation, METAL BINDING PROTEIN
Deposited on 2011-11-17, released 2012-09-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2llta_
  • Chain 'B':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lltb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lltA (A:)
    gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
    ldengdgevdfqeyvvlvaaltvacnnffwens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lltB (B:)
    gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
    ldengdgevdfqeyvvlvaaltvacnnffwens