PDB entry 2lls

View 2lls on RCSB PDB site
Description: solution structure of human apo-S100A1 C85M
Class: metal binding protein
Keywords: S100 protein family, calcium binding protein, METAL BINDING PROTEIN
Deposited on 2011-11-17, released 2012-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein S100-A1
  Species: Homo sapiens [TaxId:9606]
  Gene: S100A1, S100A
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23297 (0-92)
    • engineered mutation (84)
  Domains in SCOPe 2.08: d2llsa_
• Chain 'B':
  Compound: Protein S100-A1
  Species: Homo sapiens [TaxId:9606]
  Gene: S100A1, S100A
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23297 (0-92)
    • engineered mutation (84)
  Domains in SCOPe 2.08: d2llsb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2llsA (A:)
  gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
  ldengdgevdfqeyvvlvaaltvamnnffwens
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2llsB (B:)
  gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
  ldengdgevdfqeyvvlvaaltvamnnffwens