PDB entry 2lkx

View 2lkx on RCSB PDB site
Description: NMR structure of the homeodomain of Pitx2 in complex with a TAATCC DNA binding site
Class: transcription/DNA
Keywords: TRANSCRIPTION-DNA complex
Deposited on 2011-10-21, released 2012-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pituitary homeobox 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PITX3, PTX3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75364 (2-61)
      • expression tag (0-1)
      • expression tag (62-67)
    Domains in SCOPe 2.08: d2lkxa1, d2lkxa2, d2lkxa3
  • Chain 'B':
    Compound: DNA (5'-d(*gp*cp*tp*cp*tp*ap*ap*tp*cp*cp*cp*cp*g)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*cp*gp*gp*gp*gp*ap*tp*tp*ap*gp*ap*gp*c)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lkxA (A:)
    gsqrrqrthftsqqlqeleatfqrnrypdmstreeiavwtnltearvrvwfknrrakwrk
    reefivtd
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.