PDB entry 2lkv

View 2lkv on RCSB PDB site
Description: Staphylococcal Nuclease PHS variant
Class: hydrolase
Keywords: hydrolase
Deposited on 2011-10-21, released 2012-09-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-09-12, with a file datestamp of 2012-09-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:196620]
    Gene: nuc, MW0769
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NXI6 (0-148)
      • engineered mutation (116)
      • engineered mutation (127)
    Domains in SCOPe 2.05: d2lkva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lkvA (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnnt
heqllrkaeaqakkeklniwsednadsgq