PDB entry 2lk5

View 2lk5 on RCSB PDB site
Description: Solution structure of the Zn(II) form of Desulforedoxin
Class: electron transport
Keywords: electron transport
Deposited on 2011-10-06, released 2012-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: desulforedoxin
    Species: Desulfovibrio gigas [TaxId:879]
    Gene: dsr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lk5a_
  • Chain 'B':
    Compound: desulforedoxin
    Species: Desulfovibrio gigas [TaxId:879]
    Gene: dsr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lk5b_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lk5A (A:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lk5B (B:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq