PDB entry 2lk4

View 2lk4 on RCSB PDB site
Description: Structural and mechanistic insights into the interaction between PAT Pyk2 and Paxillin LD motif
Class: transferase
Keywords: transferase
Deposited on 2011-10-04, released 2012-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-31, with a file datestamp of 2014-12-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein-tyrosine kinase 2-beta
  Species: Homo sapiens [TaxId:9606]
  Gene: PTK2B, FAK2, PYK2, RAFTK
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14289 (0-134)
    • conflict (28)
    • conflict (101)
  Domains in SCOPe 2.08: d2lk4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lk4A (A:)
  anldrtddlvylnvmelvravlelknelsqlppegyvvvvknvgltlrkligsvddllps
  lpsssrteiegtqkllnkdlaelinkmrlaqqnavtslseeakrqmltashtlavdaknl
  ldavdqakvlanlah