PDB entry 2ljz

View 2ljz on RCSB PDB site
Description: Structure of the C-terminal domain of HPV16 E6 oncoprotein
Class: metal binding protein
Keywords: metal binding protein
Deposited on 2011-09-30, released 2012-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein E6
    Species: Human papillomavirus [TaxId:333760]
    Gene: E6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03126 (3-74)
      • expression tag (0-2)
      • engineered mutation (3)
      • engineered mutation (20)
      • engineered mutation (34)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d2ljza1, d2ljza2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ljzA (A:)
    gamsyslygttleqqynkplsdllircincqkplspeekqrhldkkqrfhnirgrwtgrc
    mscsrssrtrretql