PDB entry 2ljr

View 2ljr on RCSB PDB site
Description: glutathione transferase apo-form from human
Class: transferase
Keywords: transferase
Deposited on 1998-03-08, released 1999-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.2
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ljra1, d2ljra2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ljrb1, d2ljrb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ljrA (A:)
    mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
    dfiltessailiylsckyqtpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlg
    pligvqvpeekvernrtamdqalqwledkflgdrpflagqqvtladlmaleelmqpvalg
    yelfegrprlaawrgrveaflgaelcqeahsiilsileqaakktlptpspeayqamllri
    arip
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ljrB (B:)
    mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
    dfiltessailiylsckyqtpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlg
    pligvqvpeekvernrtamdqalqwledkflgdrpflagqqvtladlmaleelmqpvalg
    yelfegrprlaawrgrveaflgaelcqeahsiilsileqaakktlptpspeayqamllri
    arip