PDB entry 2ljp

View 2ljp on RCSB PDB site
Description: Backbone 1H, 13C, and 15N Chemical Shift Assignments for E.coli Ribonuclease P protein
Class: hydrolase
Keywords: RNaseP, C5, ribonuclease P, Ribozyme, HYDROLASE
Deposited on 2011-09-21, released 2011-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease P protein component
    Species: Escherichia coli [TaxId:83333]
    Gene: rnpA, b3704, JW3681
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ljpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ljpA (A:)
mvklafprelrlltpsqftfvfqqpqragtpqitilgrlnslghprigltvakknvrrah
ernrikrltresfrlrqhelpamdfvvvakkgvadldnralsealeklwrrhcrlargs