PDB entry 2ljo

View 2ljo on RCSB PDB site
Description: 3D solution structure of lipid transfer protein Lc-LTP2
Class: lipid transport
Keywords: lipid transport
Deposited on 2011-09-21, released 2012-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Non-specific lipid-transfer protein 2
  Species: Lens culinaris [TaxId:3864]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0AT29 (0-92)
  Domains in SCOPe 2.07: d2ljoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ljoA (A:)
  aiscgavtsdlspcltyltggpgpspqccggvkkllaaanttpdrqaacnclksaagsit
  klntnnaaalpgkcgvnipykistttncntvkf