PDB entry 2ljh

View 2ljh on RCSB PDB site
Description: NMR structure of Double-stranded RNA-specific editase Adar
Class: hydrolase
Keywords: dsRBD, dsRBM, editing, HYDROLASE
Deposited on 2011-09-13, released 2012-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Double-stranded RNA-specific editase Adar
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Adar, hypnos-2, CG12598
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ljha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ljhA (A:)
    mgsshhhhhhssglvprgshmsdpkkkmckeripqpkntvamlnelrhgliyklesqtgp
    vhaplftisvevdgqkylgqgrskkvarieaaatalrsfiqfkdgavlsplkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ljhA (A:)
    sdpkkkmckeripqpkntvamlnelrhgliyklesqtgpvhaplftisvevdgqkylgqg
    rskkvarieaaatalrsfiqfkdgavlsplkpa