PDB entry 2lj0

View 2lj0 on RCSB PDB site
Description: The third SH3 domain of R85FL
Class: signaling protein
Keywords: SH3, R85FL, ponsin, CAP, SIGNALING PROTEIN
Deposited on 2011-09-02, released 2012-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sorbin and SH3 domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SORBS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2lj0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lj0A (A:)
    qtsqdlfsyqalysyipqnddelelrdgdivdvmekcddgwfvgtsrrtkqfgtfpgnyv
    kplyl