PDB entry 2lit

View 2lit on RCSB PDB site
Description: NMR Solution Structure of Yeast Iso-1-cytochrome c Mutant P71H in reduced states
Class: metal transport
Keywords: cytochrome c, P71H, reduced, METAL TRANSPORT
Deposited on 2011-08-31, released 2011-12-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • engineered mutation (75-76)
      • engineered mutation (106)
    Domains in SCOPe 2.04: d2lita_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2litA (A:)
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnhakyipgtkmafgglkkekdrndlitylkkate