PDB entry 2lis

View 2lis on RCSB PDB site
Description: high resolution structure of the red abalone lysin monomer
Class: cell adhesion
Keywords: abalone lysin, fertilization protein, gamete recognition protein, cell adhesion
Deposited on 1999-04-16, released 2000-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sperm lysin
    Species: Haliotis rufescens [TaxId:6454]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2lisa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lisA (A:)
    rswhyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqt
    hwanymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymee
    inrmrpadvpvkymgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lisA (A:)
    hyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwa
    nymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinr
    mrpadvpvkym