PDB entry 2li6

View 2li6 on RCSB PDB site
Description: 1H, 13C, and 15N Chemical Shift Assignments for yeast protein
Class: DNA binding protein
Keywords: Ligand binding, DNA BINDING PROTEIN
Deposited on 2011-08-24, released 2012-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SWI/SNF chromatin-remodeling complex subunit SWI1
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: ADR6, GAM3, SWI1, YPL016W, LPA1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09547 (0-115)
  Domains in SCOPe 2.08: d2li6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2li6A (A:)
  qslnpalqekistelnnkqyelfmkslienckkrnmplqsipeignrkinlfylymlvqk
  fggadqvtrtqqwsmvaqrlqisdyqqlesiyfrillpyerhmisqegiketqakr