PDB entry 2lhs

View 2lhs on RCSB PDB site
Description: Structure of the chitin binding protein 21 (CBP21)
Class: Chitin Binding Protein
Keywords: Chitin binding protein
Deposited on 2011-08-15, released 2011-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cbp21
    Species: SERRATIA MARCESCENS [TaxId:615]
    Gene: CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lhsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lhsA (A:)
    hgyvespasrayqcklqlntqcgsvqyepqsveglkgfpqagpadghiasadkstffeld
    qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
    ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk