PDB entry 2lhl

View 2lhl on RCSB PDB site
Description: Chemical Shift Assignments and solution structure of human apo-S100A1 E32Q mutant
Class: metal binding protein
Keywords: calcium binding protein, 15N relaxation, S100 protein family, METAL BINDING PROTEIN
Deposited on 2011-08-12, released 2012-08-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23297 (0-92)
      • engineered mutation (31)
    Domains in SCOPe 2.06: d2lhla_
  • Chain 'B':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23297 (0-92)
      • engineered mutation (31)
    Domains in SCOPe 2.06: d2lhlb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lhlA (A:)
    gseletametlinvfhahsgkegdkyklskkqlkellqtelsgfldaqkdvdavdkvmke
    ldengdgevdfqeyvvlvaaltvacnnffwens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lhlB (B:)
    gseletametlinvfhahsgkegdkyklskkqlkellqtelsgfldaqkdvdavdkvmke
    ldengdgevdfqeyvvlvaaltvacnnffwens