PDB entry 2lhj

View 2lhj on RCSB PDB site
Description: NMR structure of the high mobility group protein-like protein NHP1 from Babesia bovis T2Bo (BaboA.00841.a)
Class: structural genomics, unknown function
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, UNKNOWN FUNCTION
Deposited on 2011-08-11, released 2011-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: High mobility group protein homolog NHP1
  Species: Babesia bovis [TaxId:5865]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40632 (0-96)
  Domains in SCOPe 2.08: d2lhja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lhjA (A:)
  magasdrtgvrrprkakkdpnapkralssymffakekrveiiaenpeiakdvaaigkmig
  aawnalsdeekkpyermsdedrvryerekaeyaqrkv