PDB entry 2lhh

View 2lhh on RCSB PDB site
Description: Solution structure of Ca2+-bound yCaM
Class: metal binding protein
Keywords: yeast calmodulin, METAL BINDING PROTEIN
Deposited on 2011-08-10, released 2012-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: CMD1, YBR109C, YBR0904
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06787 (0-119)
    • expression tag (120-127)
  Domains in SCOPe 2.06: d2lhha1, d2lhha2
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lhhA (A:)
  ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn
  hqiefseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltdae
  lehhhhhh