PDB entry 2lhb

View 2lhb on RCSB PDB site
Description: refinement of a molecular model for lamprey hemoglobin from petromyzon marinus
Deposited on 1985-08-16, released 1986-01-21
The last revision prior to the SCOP 1.71 freeze date was dated 1991-04-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.142
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d2lhb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lhb_ (-)
    pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
    adelkksadvrwhaeriinavddavasmddtekmsmklrnlsgkhaksfqvdpeyfkvla
    aviadtvaagdagfeklmsmicillrsay