PDB entry 2lha

View 2lha on RCSB PDB site
Description: Solution structure of C2B with IP6
Class: metal binding protein
Keywords: Protein-Drug complex, Beta-sheet protein, Calcium binding protein, METAL BINDING PROTEIN
Deposited on 2011-08-08, released 2012-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SYT1, SVP65, SYT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lhaa_
  • Heterogens: IHP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lhaA (A:)
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanprrpiaqwhtlqveeevdamlavkk