PDB entry 2lgs

View 2lgs on RCSB PDB site
Description: feedback inhibition of fully unadenylylated glutamine synthetase from salmonella typhimurium by glycine, alanine, and serine
Class: ligase(amide synthetase)
Keywords: ligase(amide synthetase)
Deposited on 1994-08-05, released 1994-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.235
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lgsa1, d2lgsa2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lgsb1, d2lgsb2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lgsc1, d2lgsc2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lgsd1, d2lgsd2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lgse1, d2lgse2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lgsf1, d2lgsf2
  • Chain 'G':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lgsg1, d2lgsg2
  • Chain 'H':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lgsh1, d2lgsh2
  • Chain 'I':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lgsi1, d2lgsi2
  • Chain 'J':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lgsj1, d2lgsj2
  • Chain 'K':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lgsk1, d2lgsk2
  • Chain 'L':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2lgsl1, d2lgsl2
  • Heterogens: MN, GLU

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lgsA (A:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lgsA (A:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2lgsB (B:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lgsB (B:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2lgsC (C:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lgsC (C:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2lgsD (D:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lgsD (D:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2lgsE (E:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lgsE (E:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2lgsF (F:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lgsF (F:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2lgsG (G:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lgsG (G:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2lgsH (H:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lgsH (H:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2lgsI (I:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lgsI (I:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2lgsJ (J:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lgsJ (J:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2lgsK (K:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lgsK (K:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2lgsL (L:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lgsL (L:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv