PDB entry 2lgl

View 2lgl on RCSB PDB site
Description: NMR structure of the UHRF1 PHD domain
Class: ligase
Keywords: UHRF1 PHD domain, LIGASE
Deposited on 2011-07-28, released 2011-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UHRF1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lgla_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lglA (A:)
    sgpsckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsede
    wycpecrnd