PDB entry 2lgc

View 2lgc on RCSB PDB site
Description: Joint NMR and X-ray refinement reveals the structure of a novel dibenzo[a,d]cycloheptenone inhibitor/p38 MAP kinase complex in solution
Class: transferase
Keywords: P38 MAPK kinase-inhibitor complex, hybrid NMR/X-ray structure, TRANSFERASE
Deposited on 2011-07-25, released 2012-07-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539 (6-358)
      • expression tag (0-5)
    Domains in SCOPe 2.06: d2lgca1, d2lgca2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lgcA (A:)
    shmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkkl
    srpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnn
    ivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarht
    ddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkli
    lrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdk
    ritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld