PDB entry 2lfo

View 2lfo on RCSB PDB site
Description: NMR structure of cl-BABP/SS complexed with glycochenodeoxycholic and glycocholic acids
Class: lipid binding protein
Keywords: heterotypic complex, bile acid binding protein, liver, bile acids, lipid binding protein, disulphide bridge
Deposited on 2011-07-07, released 2012-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-07-11, with a file datestamp of 2012-07-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fatty acid-binding protein, liver
  Species: Gallus gallus [TaxId:9031]
  Gene: FABP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80226 (0-124)
    • variant (90)
  Domains in SCOPe 2.08: d2lfoa_
• Heterogens: GCH, CHO

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lfoA (A:)
  afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
  sftlgkeadittmdgkklkctvhlangklvcksekfsheqevkgnemvetitfggvtlir
  rskrv