PDB entry 2lfk

View 2lfk on RCSB PDB site
Description: NMR solution structure of native TdPI-short
Class: hydrolase inhibitor
Keywords: hydrolase inhibitor
Deposited on 2011-07-06, released 2011-11-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptase inhibitor
    Species: RHIPICEPHALUS APPENDICULATUS [TaxId:34631]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1EG59 (2-56)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2lfka1, d2lfka2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lfkA (A:)
gdkeectvpigwsepvkglckarftryycmgncckvyegcytggysrmgecarncpg