PDB entry 2lfj

View 2lfj on RCSB PDB site
Description: Solution structure of the monomeric derivative of BS-RNase
Class: hydrolase
Keywords: hydrolase
Deposited on 2011-07-06, released 2012-02-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Seminal ribonuclease
  Species: Bos taurus [TaxId:9913]
  Gene: SRN
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00669 (0-123)
    • engineered mutation (66)
  Domains in SCOPe 2.05: d2lfja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lfjA (A:)
  kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
  kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
  dasv