PDB entry 2lfb

View 2lfb on RCSB PDB site
Description: homeodomain from rat liver lfb1/hnf1 transcription factor, nmr, 20 structures
Class: DNA-binding
Keywords: DNA-binding, transcription factor, lfb1/hnf1, helix-turn-helix, DNA-binding domain
Deposited on 1996-12-12, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lfb1/hnf1 transcription factor
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lfba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lfbA (A:)
    maridptkkgrrnrfkwgpasqqilfqayerqknpskeeretlveecnraeciqrgvsps
    qaqglgsnlvtevrvynwfanrrkeeafrhklamdtykln