PDB entry 2lf7

View 2lf7 on RCSB PDB site
Description: Intramolecular regulation of the ETS Domain within ETV6 sequence R335 to Q436
Class: transcription
Keywords: auto-inhibition, TRANSCRIPTION
Deposited on 2011-06-28, released 2012-05-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor etv6
    Species: Mus musculus [TaxId:10090]
    Gene: Etv6, mouse ETV6, Tel, Tel1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97360 (4-105)
      • expression tag (0-3)
    Domains in SCOPe 2.05: d2lf7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lf7A (A:)
    gshmrllwdyvyqllsdsryenfirwedkeskifrivdpnglarlwgnhknrtnmtyekm
    sralrhyyklniirkepgqrllfrfmktpdeimsgrtdrlehlesq