PDB entry 2lf2

View 2lf2 on RCSB PDB site
Description: Solution NMR structure of the AHSA1-like protein CHU_1110 from Cytophaga hutchinsonii, Northeast Structural Genomics Consortium Target ChR152
Class: structural genomics, unknown function
Keywords: NESG, Structural Genomics, PSI-Biology, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2011-06-28, released 2011-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uncharacterized protein
  Species: Cytophaga hutchinsonii [TaxId:269798]
  Gene: CHU_1110
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q11W30 (0-166)
    • expression tag (167-174)
  Domains in SCOPe 2.08: d2lf2a1, d2lf2a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lf2A (A:)
  mrtdlaldfsvnkenktitikrefaavraivweaftraeildqwwapkpwkaktksmdfk
  eggtwlyamvgpngeehwsiceyaiikpierftgkdgftdasgklntemprsnwdmrfid
  kgeitevqyhisyddvaqleatiqmgfkegitmamenldellvsgkklehhhhhh