PDB entry 2leo

View 2leo on RCSB PDB site
Description: Solution structure of esophageal cancer-related gene 2
Class: hydrolase inhibitor
Keywords: Protease Inhibitor, esophageal cancer-related gene 2, HYDROLASE INHIBITOR
Deposited on 2011-06-20, released 2012-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease inhibitor Kazal-type 7
    Species: Homo sapiens [TaxId:9606]
    Gene: SPINK7, ECG2, UNQ745/PRO1474
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2leoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2leoA (A:)
seaaslspkkvdcsiykkypvvaipcpitylpvcgsdyitygnechlcteslksngrvqf
lhdgsc