PDB entry 2len

View 2len on RCSB PDB site
Description: Solution structure of UCHL1 S18Y variant
Class: Hydrolase
Keywords: hydrolase
Deposited on 2011-06-19, released 2012-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase isozyme L1
    Species: Homo sapiens [TaxId:9606]
    Gene: UCHL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09936 (0-222)
      • engineered mutation (17)
      • expression tag (223-230)
    Domains in SCOPe 2.08: d2lena1, d2lena2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lenA (A:)
mqlkpmeinpemlnkvlyrlgvagqwrfvdvlgleeeslgsvpapacallllfpltaqhe
nfrkkqieelkgqevspkvyfmkqtignscgtiglihavannqdklgfedgsvlkqflse
tekmspedrakcfekneaiqaahdavaqegqcrvddkvnfhfilfnnvdghlyeldgrmp
fpvnhgassedtllkdaakvcreftereqgevrfsavalckaalehhhhhh