PDB entry 2lea

View 2lea on RCSB PDB site
Description: Solution structure of human SRSF2 (SC35) RRM
Class: RNA binding protein
Keywords: SR protein, splicing factor, RNA binding Protein
Deposited on 2011-06-15, released 2011-11-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/arginine-rich splicing factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SFRS2, SRSF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2leaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2leaA (A:)
mgsshhhhhhssglvprgshmasmtggqqmgrgsmsygrpppdvegmtslkvdnltyrts
pdtlrrvfekygrvgdvyiprdrytkesrgfafvrfhdkrdaedamdamdgavldgrelr
vqmarygrppdshhs

    Sequence, based on observed residues (ATOM records): (download) 
    >2leaA (A:)
msygrpppdvegmtslkvdnltyrtspdtlrrvfekygrvgdvyiprdrytkesrgfafv
rfhdkrdaedamdamdgavldgrelrvqmarygrppdshhs