PDB entry 2le4

View 2le4 on RCSB PDB site
Description: Solution structure of the HMG box DNA-binding domain of human stem cell transcription factor Sox2
Class: transcription
Keywords: Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, TRANSCRIPTION, CESG
Deposited on 2011-06-06, released 2011-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor sox-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SOX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48431 (1-80)
      • expression tag (0)
    Domains in SCOPe 2.08: d2le4a1, d2le4a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2le4A (A:)
    sdrvkrpmnafmvwsrgqrrkmaqenpkmhnseiskrlgaewkllsetekrpfideakrl
    ralhmkehpdykyrprrktkt