PDB entry 2ldx

View 2ldx on RCSB PDB site
Description: characterization of the antigenic sites on the refined 3-angstroms resolution structure of mouse testicular lactate dehydrogenase c4
Class: oxidoreductase(choh(d)-nad(a))
Keywords: oxidoreductase(choh(d)-nad(a))
Deposited on 1987-11-25, released 1989-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: 0.256
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apo-lactate dehydrogenase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00342 (0-330)
      • conflict (28)
      • conflict (54)
      • conflict (64)
      • conflict (102)
      • conflict (122-123)
      • conflict (133)
      • conflict (220-221)
      • conflict (223)
      • conflict (241)
      • conflict (295)
      • conflict (327)
      • conflict (329)
    Domains in SCOPe 2.07: d2ldxa1, d2ldxa2
  • Chain 'B':
    Compound: apo-lactate dehydrogenase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00342 (0-330)
      • conflict (28)
      • conflict (54)
      • conflict (64)
      • conflict (102)
      • conflict (122-123)
      • conflict (133)
      • conflict (220-221)
      • conflict (223)
      • conflict (241)
      • conflict (295)
      • conflict (327)
      • conflict (329)
    Domains in SCOPe 2.07: d2ldxb1, d2ldxb2
  • Chain 'C':
    Compound: apo-lactate dehydrogenase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00342 (0-330)
      • conflict (28)
      • conflict (54)
      • conflict (64)
      • conflict (102)
      • conflict (122-123)
      • conflict (133)
      • conflict (220-221)
      • conflict (223)
      • conflict (241)
      • conflict (295)
      • conflict (327)
      • conflict (329)
    Domains in SCOPe 2.07: d2ldxc1, d2ldxc2
  • Chain 'D':
    Compound: apo-lactate dehydrogenase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00342 (0-330)
      • conflict (28)
      • conflict (54)
      • conflict (64)
      • conflict (102)
      • conflict (122-123)
      • conflict (133)
      • conflict (220-221)
      • conflict (223)
      • conflict (241)
      • conflict (295)
      • conflict (327)
      • conflict (329)
    Domains in SCOPe 2.07: d2ldxd1, d2ldxd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ldxA (A:)
    stvkeqliqnlvpedklsrckitvvgvgdvgmacaisillkgladelalvdadtdklrge
    aldlqhgslflstpkivfgkdynvsansklviitagarmvsgqtrldllqrnvaimkaiv
    pgviqnspdckiivvtnpvdiltyvvwkisgfpvgrvigsgcnldsarfryligeklgvn
    ptschgwvlgehgdssvpiwsgvnvagvtlkslnpaigtdknkqhwknvhkqvveggyev
    ldmkgytswaiglsvtdlarsilknlkrvhpvttlvkgfhgikeevflsipcvlgesgit
    dfvkvnmtaeeegllkksadtlwnmqknlel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ldxB (B:)
    stvkeqliqnlvpedklsrckitvvgvgdvgmacaisillkgladelalvdadtdklrge
    aldlqhgslflstpkivfgkdynvsansklviitagarmvsgqtrldllqrnvaimkaiv
    pgviqnspdckiivvtnpvdiltyvvwkisgfpvgrvigsgcnldsarfryligeklgvn
    ptschgwvlgehgdssvpiwsgvnvagvtlkslnpaigtdknkqhwknvhkqvveggyev
    ldmkgytswaiglsvtdlarsilknlkrvhpvttlvkgfhgikeevflsipcvlgesgit
    dfvkvnmtaeeegllkksadtlwnmqknlel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ldxC (C:)
    stvkeqliqnlvpedklsrckitvvgvgdvgmacaisillkgladelalvdadtdklrge
    aldlqhgslflstpkivfgkdynvsansklviitagarmvsgqtrldllqrnvaimkaiv
    pgviqnspdckiivvtnpvdiltyvvwkisgfpvgrvigsgcnldsarfryligeklgvn
    ptschgwvlgehgdssvpiwsgvnvagvtlkslnpaigtdknkqhwknvhkqvveggyev
    ldmkgytswaiglsvtdlarsilknlkrvhpvttlvkgfhgikeevflsipcvlgesgit
    dfvkvnmtaeeegllkksadtlwnmqknlel
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ldxD (D:)
    stvkeqliqnlvpedklsrckitvvgvgdvgmacaisillkgladelalvdadtdklrge
    aldlqhgslflstpkivfgkdynvsansklviitagarmvsgqtrldllqrnvaimkaiv
    pgviqnspdckiivvtnpvdiltyvvwkisgfpvgrvigsgcnldsarfryligeklgvn
    ptschgwvlgehgdssvpiwsgvnvagvtlkslnpaigtdknkqhwknvhkqvveggyev
    ldmkgytswaiglsvtdlarsilknlkrvhpvttlvkgfhgikeevflsipcvlgesgit
    dfvkvnmtaeeegllkksadtlwnmqknlel