PDB entry 2ldu

View 2ldu on RCSB PDB site
Description: Solution NMR Structure of Heat shock factor protein 1 DNA binding domain from homo sapiens, Northeast Structural Genomics Consortium Target HR3023C
Class: chaperone
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), DNA-binding, PSI-Biology, Protein Structure Initiative, CHAPERONE
Deposited on 2011-06-01, released 2011-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock factor protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSF1, HSF1_HUMAN, HSTF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00613 (11-124)
      • expression tag (0-10)
    Domains in SCOPe 2.08: d2ldua1, d2ldua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lduA (A:)
    mghhhhhhshmagpsnvpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlp
    kyfkhnnmasfvrqlnmygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikrk
    vtsvs