PDB entry 2ldi

View 2ldi on RCSB PDB site
Description: NMR solution structure of ZiaAN sub mutant
Class: hydrolase
Keywords: metal homeostasis, metallochaperones, HYDROLASE
Deposited on 2011-05-26, released 2011-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc-transporting ATPase
    Species: Synechocystis sp. [TaxId:1148]
    Gene: ziaA, slr0798
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59998 (0-70)
      • conflict (12)
      • conflict (14-15)
      • conflict (17-19)
      • conflict (22-23)
    Domains in SCOPe 2.06: d2ldia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ldiA (A:)
plktqqmqvggmrcaacassieralerlkgvaeasvtvatgrltvtydpkqvseitiqer
iaalgytlaep