PDB entry 2ldb

View 2ldb on RCSB PDB site
Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase
Class: oxidoreductase(choh(d)-nad(a))
Keywords: oxidoreductase(choh(d)-nad(a))
Deposited on 1989-03-27, released 1989-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ldba1, d2ldba2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ldbb1, d2ldbb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ldbc1, d2ldbc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ldbd1, d2ldbd2
  • Heterogens: SO4, NAD, FBP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ldbA (A:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraftr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ldbA (A:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwdyddcrdadlvvicagaldlvdkniaifrsivesvmasgfqglflvatnpvdilt
    yatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqa
    yigvmpirklveskdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenail
    tvsayldglygerdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft
    r
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ldbB (B:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraftr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ldbB (B:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwdyddcrdadlvvicagaldlvdkniaifrsivesvmasgfqglflvatnpvdilt
    yatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqa
    yigvmpirklveskdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenail
    tvsayldglygerdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft
    r
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ldbC (C:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraftr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ldbC (C:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwdyddcrdadlvvicagaldlvdkniaifrsivesvmasgfqglflvatnpvdilt
    yatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqa
    yigvmpirklveskdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenail
    tvsayldglygerdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft
    r
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ldbD (D:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraftr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ldbD (D:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwdyddcrdadlvvicagaldlvdkniaifrsivesvmasgfqglflvatnpvdilt
    yatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqa
    yigvmpirklveskdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenail
    tvsayldglygerdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraft
    r