PDB entry 2lcv

View 2lcv on RCSB PDB site
Description: Structure of the Cytidine Repressor DNA-Binding Domain; an alternate calculation
Class: transcription regulator
Keywords: bacterial gene repressor, helix turn helix binding domain, lacr family, DNA-binding, repressor, transcription, transcription regulation, DNA binding protein, transcription regulator
Deposited on 2011-05-10, released 2011-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: HTH-type transcriptional repressor CytR
  Species: Escherichia coli [TaxId:83333]
  Gene: cytR, b3934, JW3905
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ACN7 (0-46)
  Domains in SCOPe 2.06: d2lcva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lcvA (A:)
  aatmkdvalkakvstatvsralmnpdkvsqatrnrvekaarevgylp