PDB entry 2lcv

View 2lcv on RCSB PDB site
Description: Structure of the Cytidine Repressor DNA-Binding Domain; an alternate calculation
Class: transcription regulator
Keywords: bacterial gene repressor, helix turn helix binding domain, lacr family, DNA-binding, repressor, transcription, transcription regulation, DNA binding protein, transcription regulator
Deposited on 2011-05-10, released 2011-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional repressor CytR
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b3934, cytR, JW3905
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2lcva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2lcvA (A:)
    mkakkqetaatmkdvalkakvstatvsralmnpdkvsqatrnrvekaarevgylpqpmgr
    nvkrnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lcvA (A:)
    aatmkdvalkakvstatvsralmnpdkvsqatrnrvekaarevgylp