PDB entry 2lce

View 2lce on RCSB PDB site
Description: Chemical shift assignment of Hr4436B from Homo Sapiens, Northeast Structural Genomics Consortium
Class: Transcription regulator
Keywords: Structural Genomics, Northeast Structural Genomics Consortium, NESG, PSI-Biology, Protein Structure Initiative, Transcription regulator
Deposited on 2011-04-28, released 2011-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: B-cell lymphoma 6 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: BCL6, BCL5, LAZ3, ZBTB27, ZNF51
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41182 (11-73)
    • expression tag (10)
  Domains in SCOPe 2.08: d2lcea1, d2lcea2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2lceA (A:)
  mghhhhhhshmthsdkpykcdrcqasfrykgnlashktvhtgekpyrcnicgaqfnrpan
  lkthtrihsgekpy
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2lceA (A:)
  mthsdkpykcdrcqasfrykgnlashktvhtgekpyrcnicgaqfnrpanlkthtrihsg
  ekpy