PDB entry 2lc7

View 2lc7 on RCSB PDB site
Description: Solution structure of the isolated Par-6 PDZ domain
Class: cell adhesion
Keywords: CRIB, allostery, cell polarity, CELL ADHESION
Deposited on 2011-04-25, released 2011-11-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Par-6
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG5884, Dmel_CG5884, par-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2lc7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2lc7A (A:)
gsethrrvrllkhgsdkplgfyirdgtsvrvtasglekqpgifisrlvpgglaestglla
vndevievngievagktldqvtdmmvanssnliitvkpanqr

    Sequence, based on observed residues (ATOM records): (download) 
    >2lc7A (A:)
ethrrvrllkhgsdkplgfyirdgtsvrvtasglekqpgifisrlvpgglaestgllavn
devievngievagktldqvtdmmvanssnliitvkpanqr