PDB entry 2lc6

View 2lc6 on RCSB PDB site
Description: Solution structure of Par-6 Q144C/L164C
Class: cell adhesion
Keywords: PDZ domain, CRIB, Cdc42, CELL ADHESION
Deposited on 2011-04-25, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Par-6
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG5884, Dmel_CG5884, par-6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O97111 (2-127)
      • expression tag (0-1)
      • engineered mutation (16)
      • engineered mutation (36)
    Domains in SCOPe 2.07: d2lc6a1, d2lc6a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lc6A (A:)
    gsktkapsisiphdfrcvsaiidvdivpethrrvrlckhgsdkplgfyirdgtsvrvtas
    glekqpgifisrlvpgglaestgllavndevievngievagktldqvtdmmvanssnlii
    tvkpanqr