PDB entry 2lbs

View 2lbs on RCSB PDB site
Description: Solution structure of double-stranded RNA binding domain of S. cerevisiae RNase III (Rnt1p) in complex with AAGU tetraloop hairpin
Class: hydrolase/RNA
Keywords: dsRBD, AAGU tetraloop, HYDROLASE-RNA complex
Deposited on 2011-04-06, released 2011-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA (32-mer)
  
• Chain 'B':
  Compound: Ribonuclease 3
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: RNT1, YM9408.01C, YM9959.21, YMR239C
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02555 (2-89)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d2lbsb1, d2lbsb2

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2lbsB (B:)
  gsldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikia
  giraaenalrdkkmldfyakqraaiprses